Lineage for d1j6rb1 (1j6r B:3-197)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236042Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354
  4. 2236043Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families) (S)
  5. 2236052Family d.173.1.2: Hypothetical protein TM0269 [75590] (1 protein)
  6. 2236053Protein Hypothetical protein TM0269 [75591] (1 species)
  7. 2236054Species Thermotoga maritima [TaxId:2336] [75592] (1 PDB entry)
  8. 2236056Domain d1j6rb1: 1j6r B:3-197 [71599]
    Other proteins in same PDB: d1j6ra2, d1j6rb2
    structural genomics

Details for d1j6rb1

PDB Entry: 1j6r (more details), 2.3 Å

PDB Description: crystal structure of activation (adomet binding) domain of methionine synthase (tm0269) from thermotoga maritima at 2.2 a resolution
PDB Compounds: (B:) methionine synthase

SCOPe Domain Sequences for d1j6rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6rb1 d.173.1.2 (B:3-197) Hypothetical protein TM0269 {Thermotoga maritima [TaxId: 2336]}
mpkveiapseikipdnvlkaklgfggaeeipeefrktvnrayeelldaakpvvlwrdfev
dgslsfddmrltgelatkhlsgskiitvflatlgkkvdekieeyfrkgedllaffidgia
semveyalrkvdaelrmkrsnlegsfrispgygdlplslnkkiaeifkeevdvnviedsy
vlvprktitafvgwr

SCOPe Domain Coordinates for d1j6rb1:

Click to download the PDB-style file with coordinates for d1j6rb1.
(The format of our PDB-style files is described here.)

Timeline for d1j6rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j6rb2