SCOPe 2.05: Domain d1j6ra_: 1j6r A:

Lineage for d1j6ra_ (1j6r A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354

4. Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families)

5. Family d.173.1.2: Hypothetical protein TM0269 [75590] (1 protein)

6. Protein Hypothetical protein TM0269 [75591] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75592] (1 PDB entry)

8. Domain d1j6ra_: 1j6r A: [71598]
   structural genomics

Details for d1j6ra_

PDB Entry: 1j6r, 2.3 Å

PDB Description: crystal structure of activation (adomet binding) domain of methionine synthase (tm0269) from thermotoga maritima at 2.2 a resolution

PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1j6ra_:

Sequence; same for both SEQRES and ATOM records:

>d1j6ra_ d.173.1.2 (A:) Hypothetical protein TM0269 {Thermotoga maritima [TaxId: 2336]}
hhmpkveiapseikipdnvlkaklgfggaeeipeefrktvnrayeelldaakpvvlwrdf
evdgslsfddmrltgelatkhlsgskiitvflatlgkkvdekieeyfrkgedllaffidg
iasemveyalrkvdaelrmkrsnlegsfrispgygdlplslnkkiaeifkeevdvnvied
syvlvprktitafvgwr

Timeline for d1j6ra_:

• d1j6ra_ first appeared in SCOP 1.61
  
• d1j6ra_ appears in SCOPe 2.04
  
• d1j6ra_ is called d1j6ra1 in SCOPe 2.06
  
• d1j6ra_ appears in the current release, SCOPe 2.08, called d1j6ra1