SCOPe 2.06: Domain d1j5ya1: 1j5y A:3-67

Lineage for d1j5ya1 (1j5y A:3-67)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)
   automatically mapped to Pfam PF08279

6. Protein Putative transcriptional regulator TM1602, N-terminal domain [74674] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [74675] (1 PDB entry)

8. Domain d1j5ya1: 1j5y A:3-67 [71592]
   Other proteins in same PDB: d1j5ya2
   structural genomics
   complexed with k, ni

Details for d1j5ya1

PDB Entry: 1j5y, 2.3 Å

PDB Description: crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution

PDB Compounds: (A:) transcriptional regulator, biotin repressor family

SCOPe Domain Sequences for d1j5ya1:

Sequence; same for both SEQRES and ATOM records:

>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mktvrqerlksivrilerskepvsgaqlaeelsvsrqvivqdiaylrslgynivatprgy
vlagg

Timeline for d1j5ya1:

• d1j5ya1 first appeared in SCOP 1.61
  
• d1j5ya1 appears in SCOPe 2.05
  
• d1j5ya1 appears in SCOPe 2.07
  
• d1j5ya1 appears in the current release, SCOPe 2.08