Lineage for d1j5xa_ (1j5x A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140245Family c.80.1.1: double-SIS domain [53698] (5 protein domains)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2140274Protein Hypothetical protein TM0813 [75314] (1 species)
  7. 2140275Species Thermotoga maritima [TaxId:2336] [75315] (1 PDB entry)
  8. 2140276Domain d1j5xa_: 1j5x A: [71591]
    structural genomics

Details for d1j5xa_

PDB Entry: 1j5x (more details), 1.8 Å

PDB Description: Crystal structure of Glucosamine-6-phosphate deaminase (TM0813) from Thermotoga maritima at 1.8 A resolution
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d1j5xa_:

Sequence, based on SEQRES records: (download)

>d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]}
sktlkeitdqknelkkffenfvlnlekteifseiqknltdevlfvgcgssynlaltisyy
fervlkirtkaipagevafqkipdleerglaflfsrtgnttevllandvlkkrnhrtigi
tieeesrlakesdlplvfpvreeaivmtksfsmillslmfladkiagnsterfselvgys
peffdiswkviekidlkehdhfvflgmseffgvslesalkciemsltfseaystleyrhg
pkalvkkgtlvfmqkvsgmdeqekrlrkeleslgatvlevgeggdipvsndwksaflrtv
paqilgyqkaisrgispdkpphlektvvl

Sequence, based on observed residues (ATOM records): (download)

>d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]}
sktlkeitdqknelkkffenfvlnlekitdevlfvgcgssynlaltisyyfervlkirtk
aipagevafqkipdleerglaflfsrtgnttevllandvlkkrnhrtigitieeesrlak
esdlplvfpvreeaivmtksfsmillslmfladkiagnsterfselvgyspeffdiswkv
iekidlkehdhfvflgmseffgvslesalkciemsltfseaystleyrhgpkalvkkgtl
vfmqkvsgmdeqekrlrkeleslgatvlevgeggdipvsndwksaflrtvpaqilgyqka
isrgispdkpphlektvvl

SCOPe Domain Coordinates for d1j5xa_:

Click to download the PDB-style file with coordinates for d1j5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j5xa_: