Lineage for d1j5va_ (1j5v A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401546Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 401547Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 401548Family c.72.1.1: Ribokinase-like [53614] (5 proteins)
  6. 401549Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 401550Species Thermotoga maritima, TM0067 [TaxId:2336] [75296] (1 PDB entry)
  8. 401551Domain d1j5va_: 1j5v A: [71585]

Details for d1j5va_

PDB Entry: 1j5v (more details), 2.3 Å

PDB Description: Crystal structure of 2-keto-3-deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.3 A resolution

SCOP Domain Sequences for d1j5va_:

Sequence, based on SEQRES records: (download)

>d1j5va_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067}
hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
qkvmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktv
gitlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsq
kkaefaaaasclkhtipgdfvvlsieeieklas

Sequence, based on observed residues (ATOM records): (download)

>d1j5va_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067}
hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
qkvmipfmeyvdvlianeediekvlgisnreayakiaeevtrkynfktvgitlresisat
vnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaasc
lkhtipgdfvvlsieeieklas

SCOP Domain Coordinates for d1j5va_:

Click to download the PDB-style file with coordinates for d1j5va_.
(The format of our PDB-style files is described here.)

Timeline for d1j5va_: