Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.208: MTH1598-like [69818] (1 superfamily) beta(2)-alpha-beta-alpha-beta(4); 3 layers: beta/alpha/beta; some similarity to the Hsp33 fold |
Superfamily d.208.1: MTH1598-like [69819] (1 family) automatically mapped to Pfam PF01951 |
Family d.208.1.1: MTH1598-like [69820] (2 proteins) |
Protein Hypothetical protein TM1083 [75550] (1 species) |
Species Thermotoga maritima [TaxId:2336] [75551] (1 PDB entry) |
Domain d1j5ua1: 1j5u A:7-130 [71584] Other proteins in same PDB: d1j5ua2 structural genomics complexed with ca |
PDB Entry: 1j5u (more details), 2 Å
SCOPe Domain Sequences for d1j5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5ua1 d.208.1.1 (A:7-130) Hypothetical protein TM1083 {Thermotoga maritima [TaxId: 2336]} mrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmypleetedaffdt vndwileiskgwapwrikregnelkvtfrkirkkegteikaltyhllkferdgdvlktkv vfdt
Timeline for d1j5ua1: