Lineage for d1j5sb_ (1j5s B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442420Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 2442493Protein Uronate isomerase TM0064 [75083] (1 species)
  7. 2442494Species Thermotoga maritima [TaxId:2336] [75084] (1 PDB entry)
  8. 2442496Domain d1j5sb_: 1j5s B: [71581]
    Other proteins in same PDB: d1j5sa2
    structural genomics

Details for d1j5sb_

PDB Entry: 1j5s (more details), 2.85 Å

PDB Description: crystal structure of uronate isomerase (tm0064) from thermotoga maritima at 2.85 a resolution
PDB Compounds: (B:) uronate isomerase

SCOPe Domain Sequences for d1j5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5sb_ c.1.9.8 (B:) Uronate isomerase TM0064 {Thermotoga maritima [TaxId: 2336]}
mflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvwe
lmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseeta
eeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeavegvtilptwrpd
ramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvasdhallepsvy
yvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtqlhigalrdyrds
lfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlptistiarafpnv
yvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrvlsnvvg
emvekgqipikearelvkhvsydgpkalff

SCOPe Domain Coordinates for d1j5sb_:

Click to download the PDB-style file with coordinates for d1j5sb_.
(The format of our PDB-style files is described here.)

Timeline for d1j5sb_: