SCOPe 2.06: Domain d1j5pa3: 1j5p A:109-211

Lineage for d1j5pa3 (1j5p A:109-211)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Hypothetical protein TM1643 [75487] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75488] (2 PDB entries)

8. Domain d1j5pa3: 1j5p A:109-211 [71577]
   Other proteins in same PDB: d1j5pa4, d1j5pa5
   complexed with nad

Details for d1j5pa3

PDB Entry: 1j5p, 1.9 Å

PDB Description: crystal structure of aspartate dehydrogenase (tm1643) from thermotoga maritima at 1.9 a resolution

PDB Compounds: (A:) aspartate dehydrogenase

SCOPe Domain Sequences for d1j5pa3:

Sequence; same for both SEQRES and ATOM records:

>d1j5pa3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]}
aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
iglivgfekvkvtivadpamdhnihivrissaignyefkieni

Timeline for d1j5pa3:

• d1j5pa3 first appeared in SCOP 1.61
  
• d1j5pa3 appears in SCOPe 2.05
  
• d1j5pa3 appears in SCOPe 2.07
  
• d1j5pa3 appears in the current release, SCOPe 2.08