Lineage for d1j5pa3 (1j5p A:109-211)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins) Protein Hypothetical protein TM1643 [75487] (1 species) Species Thermotoga maritima [TaxId:243274] [75488] (2 PDB entries) 
Domain d1j5pa3: 1j5p A:109-211 [71577]
Other proteins in same PDB: d1j5pa1, d1j5pa2
Details for d1j5pa3
PDB Entry: 1j5p (more details), 1.9 Å
PDB Description: crystal structure of aspartate dehydrogenase (tm1643) from thermotoga maritima at 1.9 a resolution
SCOP Domain Sequences for d1j5pa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5pa3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima}
aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
iglivgfekvkvtivadpamdhnihivrissaignyefkieni
SCOP Domain Coordinates for d1j5pa3:
Click to download the PDB-style file with coordinates for d1j5pa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j5pa3:
- d1j5pa3 is new in SCOP 1.61
- d1j5pa3 appears in SCOP 1.63
- d1j5pa3 appears in the current release, SCOPe 2.08
View in 3D
