Lineage for d1j5pa3 (1j5p A:109-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962090Protein Hypothetical protein TM1643 [75487] (1 species)
  7. 2962091Species Thermotoga maritima [TaxId:2336] [75488] (2 PDB entries)
  8. 2962092Domain d1j5pa3: 1j5p A:109-211 [71577]
    Other proteins in same PDB: d1j5pa4, d1j5pa5
    complexed with nad

Details for d1j5pa3

PDB Entry: 1j5p (more details), 1.9 Å

PDB Description: crystal structure of aspartate dehydrogenase (tm1643) from thermotoga maritima at 1.9 a resolution
PDB Compounds: (A:) aspartate dehydrogenase

SCOPe Domain Sequences for d1j5pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5pa3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]}
aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
iglivgfekvkvtivadpamdhnihivrissaignyefkieni

SCOPe Domain Coordinates for d1j5pa3:

Click to download the PDB-style file with coordinates for d1j5pa3.
(The format of our PDB-style files is described here.)

Timeline for d1j5pa3: