Lineage for d1j5ol2 (1j5o L:108-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159556Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)
  8. 159562Domain d1j5ol2: 1j5o L:108-214 [71574]
    Other proteins in same PDB: d1j5oa1, d1j5oa2, d1j5ob1, d1j5oh1, d1j5ol1

Details for d1j5ol2

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5ol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ol2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd
skdstysmsstltltadeyeaansytcaathktstspivksfnanec

SCOP Domain Coordinates for d1j5ol2:

Click to download the PDB-style file with coordinates for d1j5ol2.
(The format of our PDB-style files is described here.)

Timeline for d1j5ol2: