SCOP 1.71: Domain d1j5ol1: 1j5o L:1-107

Lineage for d1j5ol1 (1j5o L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1j5ol1: 1j5o L:1-107 [71573]
   Other proteins in same PDB: d1j5oa1, d1j5oa2, d1j5ob_, d1j5oh1, d1j5oh2, d1j5ol2
   part of Fab 28 against HIV-1 RT
   mutant

Details for d1j5ol1

PDB Entry: 1j5o, 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5ol1:

Sequence; same for both SEQRES and ATOM records:

>d1j5ol1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

Timeline for d1j5ol1:

• d1j5ol1 first appeared in SCOP 1.61
  
• d1j5ol1 appears in SCOP 1.69
  
• d1j5ol1 appears in SCOP 1.73
  
• d1j5ol1 appears in the current release, SCOPe 2.08