Lineage for d1j5oh1 (1j5o H:1-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652858Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
  8. 652872Domain d1j5oh1: 1j5o H:1-123 [71571]
    Other proteins in same PDB: d1j5oa1, d1j5oa2, d1j5ob_, d1j5oh2, d1j5ol1, d1j5ol2
    part of Fab 28 against HIV-1 RT
    mutant

Details for d1j5oh1

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
PDB Compounds: (H:) antibody (heavy chain)

SCOP Domain Sequences for d1j5oh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5oh1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1j5oh1:

Click to download the PDB-style file with coordinates for d1j5oh1.
(The format of our PDB-style files is described here.)

Timeline for d1j5oh1: