Lineage for d1j5oa1 (1j5o A:430-558)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182249Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 182250Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 182260Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 182261Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)
  8. 182320Domain d1j5oa1: 1j5o A:430-558 [71568]
    Other proteins in same PDB: d1j5oa2, d1j5ob1, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2

Details for d1j5oa1

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
PDB Compounds: (A:)

SCOP Domain Sequences for d1j5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5oa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d1j5oa1:

Click to download the PDB-style file with coordinates for d1j5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1j5oa1: