Lineage for d1j5et_ (1j5e T:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150700Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 150779Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 150780Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 150781Protein Ribosomal protein S20 [46994] (1 species)
  7. 150782Species Thermus thermophilus [TaxId:274] [46995] (10 PDB entries)
  8. 150785Domain d1j5et_: 1j5e T: [71563]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5ev_

Details for d1j5et_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5et_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5et_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1j5et_:

Click to download the PDB-style file with coordinates for d1j5et_.
(The format of our PDB-style files is described here.)

Timeline for d1j5et_: