Lineage for d1j5er_ (1j5e R:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 211052Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 211053Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 211054Protein Ribosomal protein S18 [46913] (1 species)
  7. 211055Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 211059Domain d1j5er_: 1j5e R: [71561]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5er_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5er_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5er_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1j5er_:

Click to download the PDB-style file with coordinates for d1j5er_.
(The format of our PDB-style files is described here.)

Timeline for d1j5er_: