Lineage for d1j5eo_ (1j5e O:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725434Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1725435Protein Ribosomal protein S15 [47065] (3 species)
  7. 1725449Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1725455Domain d1j5eo_: 1j5e O: [71558]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5eo_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1j5eo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5eo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1j5eo_:

Click to download the PDB-style file with coordinates for d1j5eo_.
(The format of our PDB-style files is described here.)

Timeline for d1j5eo_: