SCOPe 2.05: Domain d1j5en_: 1j5e N:

Lineage for d1j5en_ (1j5e N:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d1j5en_: 1j5e N: [71557]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5en_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1j5en_:

Sequence; same for both SEQRES and ATOM records:

>d1j5en_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1j5en_:

• d1j5en_ first appeared in SCOP 1.61
  
• d1j5en_ appears in SCOPe 2.04
  
• d1j5en_ appears in SCOPe 2.06
  
• d1j5en_ appears in the current release, SCOPe 2.08