Lineage for d1j5en_ (1j5e N:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705456Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1705457Protein Ribosomal protein S14 [57753] (2 species)
  7. 1705483Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1705488Domain d1j5en_: 1j5e N: [71557]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5en_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1j5en_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5en_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1j5en_:

Click to download the PDB-style file with coordinates for d1j5en_.
(The format of our PDB-style files is described here.)

Timeline for d1j5en_: