Lineage for d1j5el_ (1j5e L:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166908Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins)
  6. 166966Protein Ribosomal protein S12 [50302] (1 species)
  7. 166967Species Thermus thermophilus [TaxId:274] [50303] (10 PDB entries)
  8. 166970Domain d1j5el_: 1j5e L: [71555]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_

Details for d1j5el_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5el_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1j5el_:

Click to download the PDB-style file with coordinates for d1j5el_.
(The format of our PDB-style files is described here.)

Timeline for d1j5el_: