Lineage for d1j5ek_ (1j5e K:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182512Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 182513Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 182525Protein Ribosomal protein S11 [53141] (1 species)
  7. 182526Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries)
  8. 182529Domain d1j5ek_: 1j5e K: [71554]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_

Details for d1j5ek_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5ek_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ek_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1j5ek_:

Click to download the PDB-style file with coordinates for d1j5ek_.
(The format of our PDB-style files is described here.)

Timeline for d1j5ek_: