Lineage for d1j5ej_ (1j5e J:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604427Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 604428Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 604429Protein Ribosomal protein S10 [55001] (1 species)
  7. 604430Species Thermus thermophilus [TaxId:274] [55002] (18 PDB entries)
  8. 604432Domain d1j5ej_: 1j5e J: [71553]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5ej_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5ej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ej_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1j5ej_:

Click to download the PDB-style file with coordinates for d1j5ej_.
(The format of our PDB-style files is described here.)

Timeline for d1j5ej_: