Lineage for d1j5ej_ (1j5e J:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) 
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) Protein Ribosomal protein S10 [55001] (1 species) Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries) 
Domain d1j5ej_: 1j5e J: [71553]
Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
Details for d1j5ej_
PDB Entry: 1j5e (more details), 3.05 Å
PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
SCOP Domain Sequences for d1j5ej_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5ej_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
SCOP Domain Coordinates for d1j5ej_:
Click to download the PDB-style file with coordinates for d1j5ej_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j5ej_:
- d1j5ej_ is new in SCOP 1.61
- d1j5ej_ appears in SCOP 1.63
- d1j5ej_ appears in the current release, SCOPe 2.08
View in 3D
