Lineage for d1j5eh_ (1j5e H:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511609Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 511610Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 511611Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 511612Protein Ribosomal protein S8 [56049] (4 species)
  7. 511622Species Thermus thermophilus [TaxId:274] [56051] (15 PDB entries)
  8. 511630Domain d1j5eh_: 1j5e H: [71551]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_

Details for d1j5eh_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5eh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1j5eh_:

Click to download the PDB-style file with coordinates for d1j5eh_.
(The format of our PDB-style files is described here.)

Timeline for d1j5eh_: