SCOP 1.61: Domain d1j5eh_: 1j5e H:

Lineage for d1j5eh_ (1j5e H:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (3 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)

8. Domain d1j5eh_: 1j5e H: [71551]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_

Details for d1j5eh_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5eh_:

Sequence; same for both SEQRES and ATOM records:

>d1j5eh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1j5eh_:

• d1j5eh_ is new in SCOP 1.61
  
• d1j5eh_ appears in SCOP 1.63
  
• d1j5eh_ appears in the current release, SCOPe 2.08