Lineage for d1j5ee2 (1j5e E:5-73)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722525Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 722526Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
    lacks the N-terminal helix
  7. 722529Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
  8. 722530Domain d1j5ee2: 1j5e E:5-73 [71548]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5ee2

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1j5ee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ee2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1j5ee2:

Click to download the PDB-style file with coordinates for d1j5ee2.
(The format of our PDB-style files is described here.)

Timeline for d1j5ee2: