SCOPe 2.05: Domain d1j5ee1: 1j5e E:74-154

Lineage for d1j5ee1 (1j5e E:74-154)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d1j5ee1: 1j5e E:74-154 [71547]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5ee1

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1j5ee1:

Sequence; same for both SEQRES and ATOM records:

>d1j5ee1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d1j5ee1:

• d1j5ee1 first appeared in SCOP 1.61
  
• d1j5ee1 appears in SCOPe 2.04
  
• d1j5ee1 appears in SCOPe 2.06
  
• d1j5ee1 appears in the current release, SCOPe 2.08