| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) |
| Domain d1j5ee1: 1j5e E:74-154 [71547] Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_ complexed with unx, zn |
PDB Entry: 1j5e (more details), 3.05 Å
SCOP Domain Sequences for d1j5ee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5ee1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg
Timeline for d1j5ee1: