Lineage for d1j5am_ (1j5a M:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1711309Domain d1j5am_: 1j5a M: [71539]
    complexed with cty, mg

Details for d1j5am_

PDB Entry: 1j5a (more details), 3.5 Å

PDB Description: structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
PDB Compounds: (M:) ribosomal protein l32

SCOPe Domain Sequences for d1j5am_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5am_ i.1.1.2 (M:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d1j5am_:

Click to download the PDB-style file with coordinates for d1j5am_.
(The format of our PDB-style files is described here.)

Timeline for d1j5am_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j5ak_, d1j5al_