Lineage for d1j4wa2 (1j4w A:104-174)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860093Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 860094Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860095Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 860106Protein Far upstream binding element, FBP [75418] (2 species)
  7. 860107Species Human (Homo sapiens) [TaxId:9606] [75419] (1 PDB entry)
  8. 860109Domain d1j4wa2: 1j4w A:104-174 [71530]
    mutant

Details for d1j4wa2

PDB Entry: 1j4w (more details)

PDB Description: complex of the kh3 and kh4 domains of fbp with a single_stranded 29mer dna oligonucleotide from the fuse element of the c-myc oncogene
PDB Compounds: (A:) FUSE binding protein

SCOP Domain Sequences for d1j4wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}
qefnfivptgktgliigkggetiksisqqsgarielqrnpppnadpnmklftirgtpqqi
dyarqlieeki

SCOP Domain Coordinates for d1j4wa2:

Click to download the PDB-style file with coordinates for d1j4wa2.
(The format of our PDB-style files is described here.)

Timeline for d1j4wa2: