Lineage for d1j4wa1 (1j4w A:1-74)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.51: Eukaryotic type KH-domain (eKH-domain) [54790] (1 superfamily) Superfamily d.51.1: Eukaryotic type KH-domain (eKH-domain) [54791] (1 family) 
Family d.51.1.1: Eukaryotic type KH-domain (eKH-domain) [54792] (7 proteins) 
Protein Far upstream binding element, FBP, KH3 and KH4 domains [75418] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75419] (1 PDB entry) 
Domain d1j4wa1: 1j4w A:1-74 [71529]
Details for d1j4wa1
PDB Entry: 1j4w (more details)
PDB Description: complex of the kh3 and kh4 domains of fbp with a single_stranded 29mer dna oligonucleotide from the fuse element of the c-myc oncogene
SCOP Domain Sequences for d1j4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP, KH3 and KH4 domains {Human (Homo sapiens)}
gshmidvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgppdraq
haaeiitdllrsvq
SCOP Domain Coordinates for d1j4wa1:
Click to download the PDB-style file with coordinates for d1j4wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j4wa1:
- d1j4wa1 is new in SCOP 1.61
- d1j4wa1 appears in SCOP 1.63
- d1j4wa1 appears in the current release, SCOPe 2.08
View in 3D
