SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j4wa1 (1j4w A:5-74)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170459Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2170460Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2170461Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 protein domains)
    an RNA-binding domain
  6. 2170474Protein Far upstream binding element, FBP [75418] (2 species)
  7. 2170475Species Human (Homo sapiens) [TaxId:9606] [75419] (1 PDB entry)
  8. 2170476Domain d1j4wa1: 1j4w A:5-74 [71529]
    Other proteins in same PDB: d1j4wa3
    protein/DNA complex

Details for d1j4wa1

PDB Entry: 1j4w (more details)

PDB Description: complex of the kh3 and kh4 domains of fbp with a single_stranded 29mer dna oligonucleotide from the fuse element of the c-myc oncogene
PDB Compounds: (A:) FUSE binding protein

SCOPe Domain Sequences for d1j4wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4wa1 d.51.1.1 (A:5-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}
idvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgppdraqhaae
iitdllrsvq

SCOPe Domain Coordinates for d1j4wa1:

Click to download the PDB-style file with coordinates for d1j4wa1.
(The format of our PDB-style files is described here.)

Timeline for d1j4wa1: