Lineage for d1j4ua_ (1j4u A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2068918Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2068919Protein Artocarpin [75022] (1 species)
  7. 2068920Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
    Uniprot Q7M1T4
  8. 2068941Domain d1j4ua_: 1j4u A: [71523]
    complexed with mma

Details for d1j4ua_

PDB Entry: 1j4u (more details), 2.9 Å

PDB Description: Structure of Artocarpin Complexed with Me-alpha-Mannose
PDB Compounds: (A:) Artocarpin

SCOPe Domain Sequences for d1j4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ua_ b.77.3.1 (A:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOPe Domain Coordinates for d1j4ua_:

Click to download the PDB-style file with coordinates for d1j4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1j4ua_: