SCOPe 2.05: Domain d1j4th_: 1j4t H:

Lineage for d1j4th_ (1j4t H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Artocarpin [75022] (1 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
   Uniprot Q7M1T4

8. Domain d1j4th_: 1j4t H: [71522]

Details for d1j4th_

PDB Entry: 1j4t, 2.4 Å

PDB Description: Structure of Artocarpin: a Lectin with Mannose Specificity (Form 2)

PDB Compounds: (H:) Artocarpin

SCOPe Domain Sequences for d1j4th_:

Sequence; same for both SEQRES and ATOM records:

>d1j4th_ b.77.3.1 (H:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

Timeline for d1j4th_:

• d1j4th_ first appeared in SCOP 1.61
  
• d1j4th_ appears in SCOPe 2.04
  
• d1j4th_ appears in SCOPe 2.06
  
• d1j4th_ appears in the current release, SCOPe 2.08