Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein Artocarpin [75022] (1 species) |
Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries) Uniprot Q7M1T4 |
Domain d1j4tf_: 1j4t F: [71520] |
PDB Entry: 1j4t (more details), 2.4 Å
SCOPe Domain Sequences for d1j4tf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4tf_ b.77.3.1 (F:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf nlpienglivgfkgrtgdlldaigihmsl
Timeline for d1j4tf_: