Lineage for d1j4sd_ (1j4s D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566741Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 566759Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 566760Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)
  6. 566761Protein Artocarpin [75022] (1 species)
  7. 566762Species Jackfruit (Artocarpus integrifolia) [75023] (5 PDB entries)
  8. 566782Domain d1j4sd_: 1j4s D: [71514]

Details for d1j4sd_

PDB Entry: 1j4s (more details), 2.5 Å

PDB Description: structure of artocarpin: a lectin with mannose specificity (form 1)

SCOP Domain Sequences for d1j4sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4sd_ b.77.3.1 (D:) Artocarpin {Jackfruit (Artocarpus integrifolia)}
asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOP Domain Coordinates for d1j4sd_:

Click to download the PDB-style file with coordinates for d1j4sd_.
(The format of our PDB-style files is described here.)

Timeline for d1j4sd_: