Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) |
Family f.19.1.1: Aquaporin-like [56895] (4 proteins) duplication: consist of two similar structural parts |
Protein Aquaporin-1 [56896] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [75642] (1 PDB entry) |
Domain d1j4na_: 1j4n A: [71510] complexed with bng |
PDB Entry: 1j4n (more details), 2.2 Å
SCOP Domain Sequences for d1j4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus) [TaxId: 9913]} masefkkklfwravvaeflamilfifisigsalgfhypiksnqttgavqdnvkvslafgl siatlaqsvghisgahlnpavtlglllscqisvlraimyiiaqcvgaivatailsgitss lpdnslglnalapgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsgplaigfsval ghllaidytgcginparsfgssvithnfqdhwifwvgpfigaalavliydfilaprssdl tdrvkvwts
Timeline for d1j4na_: