Lineage for d1ix7a_ (1ix7 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183637Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 183638Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 183639Family c.67.1.1: AAT-like [53384] (6 proteins)
  6. 183680Protein Aspartate aminotransferase, AAT [53385] (6 species)
  7. 183714Species Escherichia coli [TaxId:562] [53390] (52 PDB entries)
  8. 183729Domain d1ix7a_: 1ix7 A: [71494]

Details for d1ix7a_

PDB Entry: 1ix7 (more details), 2.2 Å

PDB Description: Aspartate Aminotransferase Active Site Mutant V39F maleate complex

SCOP Domain Sequences for d1ix7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix7a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigfykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1ix7a_:

Click to download the PDB-style file with coordinates for d1ix7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ix7a_: