Lineage for d1iwja_ (1iwj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1743964Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1743965Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
    Uniprot P00183
  8. 1744048Domain d1iwja_: 1iwj A: [71489]
    complexed with cam, hem; mutant

Details for d1iwja_

PDB Entry: 1iwj (more details), 2 Å

PDB Description: Putidaredoxin-Binding Stablilizes an Active Conformer of Cytochrome P450cam in its Reduced State; Crystal Structure of Mutant(109K) Cytochrome P450cam
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d1iwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwja_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqkqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1iwja_:

Click to download the PDB-style file with coordinates for d1iwja_.
(The format of our PDB-style files is described here.)

Timeline for d1iwja_: