Lineage for d1iwja_ (1iwj A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (37 PDB entries) 
Domain d1iwja_: 1iwj A: [71489]
Details for d1iwja_
PDB Entry: 1iwj (more details), 2 Å
PDB Description: putidaredoxin-binding stablilizes an active conformer of cytochrome p450cam in its reduced state; crystal structure of mutant(109k) cytochrome p450cam
SCOP Domain Sequences for d1iwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwja_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqkqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOP Domain Coordinates for d1iwja_:
Click to download the PDB-style file with coordinates for d1iwja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iwja_:
- d1iwja_ is new in SCOP 1.61
- d1iwja_ appears in SCOP 1.63
- d1iwja_ appears in the current release, SCOPe 2.08
View in 3D