Lineage for d1iw7n_ (1iw7 N:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574387Species Thermus thermophilus [TaxId:274] [75610] (15 PDB entries)
    Uniprot Q8RQE8; part of multichain biological unit
  8. 2574405Domain d1iw7n_: 1iw7 N: [71483]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7e_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7o_, d1iw7p1, d1iw7p2, d1iw7p3
    complexed with mg, pb

Details for d1iw7n_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution
PDB Compounds: (N:) RNA polymerase beta subunit

SCOPe Domain Sequences for d1iw7n_:

Sequence, based on SEQRES records: (download)

>d1iw7n_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d1iw7n_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
aieearkeavea

SCOPe Domain Coordinates for d1iw7n_:

Click to download the PDB-style file with coordinates for d1iw7n_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7n_: