Lineage for d1iw7m_ (1iw7 M:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 201304Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
  4. 201305Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
  5. 201306Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 201313Protein RNA-polymerase beta [64488] (2 species)
  7. 201316Species Thermus thermophilus [TaxId:274] [75609] (1 PDB entry)
  8. 201318Domain d1iw7m_: 1iw7 M: [71482]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7n_, d1iw7o_, d1iw7p_

Details for d1iw7m_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7m_ e.29.1.1 (M:) RNA-polymerase beta {Thermus thermophilus}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOP Domain Coordinates for d1iw7m_:

Click to download the PDB-style file with coordinates for d1iw7m_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7m_: