Lineage for d1iw7f_ (1iw7 F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155717Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily)
  4. 155718Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) (S)
  5. 155719Family a.112.1.1: RNA polymerase sigma subunit [48330] (3 proteins)
  6. 155727Protein sigma70 subunit fragments [48331] (2 species)
  7. 155730Species Thermus thermophilus [TaxId:274] [74766] (1 PDB entry)
  8. 155731Domain d1iw7f_: 1iw7 F: [71477]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_

Details for d1iw7f_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7f_:

Sequence, based on SEQRES records: (download)

>d1iw7f_ a.112.1.1 (F:) sigma70 subunit fragments {Thermus thermophilus}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
glidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d1iw7f_ a.112.1.1 (F:) sigma70 subunit fragments {Thermus thermophilus}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOP Domain Coordinates for d1iw7f_:

Click to download the PDB-style file with coordinates for d1iw7f_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7f_: