| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.74: DCoH-like [55247] (4 superfamilies) |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (1 PDB entry) |
| Domain d1iw7b1: 1iw7 B:1-49,B:173-229 [71472] Other proteins in same PDB: d1iw7a2, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k2, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p_ |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOP Domain Sequences for d1iw7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw7b1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d1iw7b1: