SCOPe 2.07: Domain d1iw7a2: 1iw7 A:50-172

Lineage for d1iw7a2 (1iw7 A:50-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d1iw7a2: 1iw7 A:50-172 [71471]
   Other proteins in same PDB: d1iw7a1, d1iw7b1, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7l1, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p1, d1iw7p2, d1iw7p3
   complexed with mg, pb

Details for d1iw7a2

PDB Entry: 1iw7, 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

PDB Compounds: (A:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1iw7a2:

Sequence; same for both SEQRES and ATOM records:

>d1iw7a2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d1iw7a2:

• d1iw7a2 first appeared in SCOP 1.61
  
• d1iw7a2 appears in SCOPe 2.06
  
• d1iw7a2 appears in the current release, SCOPe 2.08