SCOPe 2.04: Domain d1ivwb3: 1ivw B:97-211

Lineage for d1ivwb3 (1ivw B:97-211)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d1ivwb3: 1ivw B:97-211 [71461]
   Other proteins in same PDB: d1ivwa1, d1ivwb1
   complexed with cu

Details for d1ivwb3

PDB Entry: 1ivw, 1.8 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: late intermediate in topaquinone biogenesis

PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d1ivwb3:

Sequence; same for both SEQRES and ATOM records:

>d1ivwb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1ivwb3:

• d1ivwb3 first appeared in SCOP 1.61
  
• d1ivwb3 appears in SCOPe 2.03
  
• d1ivwb3 appears in SCOPe 2.05
  
• d1ivwb3 appears in the current release, SCOPe 2.08