Lineage for d1ivva1 (1ivv A:212-628)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165117Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 165118Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 165119Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 165120Species Arthrobacter globiformis [TaxId:1665] [50003] (7 PDB entries)
  8. 165125Domain d1ivva1: 1ivv A:212-628 [71450]
    Other proteins in same PDB: d1ivva2, d1ivva3, d1ivvb2, d1ivvb3

Details for d1ivva1

PDB Entry: 1ivv (more details), 2.1 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: early intermediate in topaquinone biogenesis
PDB Compounds: (A:)

SCOP Domain Sequences for d1ivva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivva1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 (catalytic) {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignfdygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1ivva1:

Click to download the PDB-style file with coordinates for d1ivva1.
(The format of our PDB-style files is described here.)

Timeline for d1ivva1: