SCOP 1.61: Domain d1ivua3: 1ivu A:97-211

Lineage for d1ivua3 (1ivu A:97-211)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (7 PDB entries)

8. Domain d1ivua3: 1ivu A:97-211 [71446]
   Other proteins in same PDB: d1ivua1, d1ivub1

Details for d1ivua3

PDB Entry: 1ivu, 1.9 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: initial intermediate in topaquinone biogenesis

PDB Compounds: (A:)

SCOP Domain Sequences for d1ivua3:

Sequence; same for both SEQRES and ATOM records:

>d1ivua3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1ivua3:

• d1ivua3 appears in SCOP 1.63
  
• d1ivua3 appears in the current release, SCOPe 2.07