SCOPe 2.07: Domain d1ivma_: 1ivm A:

Lineage for d1ivma_ (1ivm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Mouse (Mus musculus) [TaxId:10090] [75329] (1 PDB entry)

8. Domain d1ivma_: 1ivm A: [71442]
   lysozyme M

Details for d1ivma_

PDB Entry: 1ivm

PDB Description: solution structure of mouse lysozyme m

PDB Compounds: (A:) lysozyme M

SCOPe Domain Sequences for d1ivma_:

Sequence; same for both SEQRES and ATOM records:

>d1ivma_ d.2.1.2 (A:) Lysozyme {Mouse (Mus musculus) [TaxId: 10090]}
kvyercefartlkrngmagyygvsladwvclaqhesnyntratnynrgdqstdygifqin
srywcndgktpravnacgincsallqdditaaiqcakrvvrdpqgirawvawrahcqnrd
lsqyirncgv

Timeline for d1ivma_:

• d1ivma_ first appeared in SCOP 1.61
  
• d1ivma_ appears in SCOPe 2.06
  
• d1ivma_ appears in the current release, SCOPe 2.08