Lineage for d1iv6a_ (1iv6 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 149955Family a.4.1.4: DNA-binding domain of human telomeric protein, hTRF1 [46745] (1 protein)
  6. 149956Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)
  7. 149957Species Human (Homo sapiens) [TaxId:9606] [46747] (3 PDB entries)
  8. 149960Domain d1iv6a_: 1iv6 A: [71441]

Details for d1iv6a_

PDB Entry: 1iv6 (more details)

PDB Description: Solution Structure of the DNA Complex of Human TRF1

SCOP Domain Sequences for d1iv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv6a_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens)}
rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklklis

SCOP Domain Coordinates for d1iv6a_:

Click to download the PDB-style file with coordinates for d1iv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1iv6a_: